HPA020952

PHPT1 antibody from Sigma-Aldrich
bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020952
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020952, RRID:AB_1855331
Product name
Anti-PHPT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020952
Antibody type
Polyclonal
Antigen
14 kDa phosphohistidine phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAE
SKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECL
GGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKI
KAKYPDYE
Storage
-20C
Provider Type Product Number
- No reagents -