PAB20459

FLII antibody from Abnova Corporation
FLI, Fli1, FLIL, MGC39265

Antibody data

Product number
PAB20459
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20459, RRID:AB_10964483
Product name
FLII polyclonal antibody
Provider product page
Abnova Corporation - PAB20459
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FLII.
Antigen sequence
YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGM
LHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVD
YTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTAL
FLPRQPPMSLAEAEQLMEEWNEDL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -