HPA008903

FLII antibody from Sigma-Aldrich
FLI, Fli1, FLIL, MGC39265
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008903, RRID:AB_1848640
Product name
Anti-FLII antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008903
Antibody type
Polyclonal
Antigen
Protein flightless-1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGM
LHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVD
YTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTAL
FLPRQPPMSLAEAEQLMEEWNEDL
Storage
-20C
Provider Type Product Number
- No reagents -