Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501446 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Endothelial Differentiation Related Factor 1 (EDF1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EDF1 antibody: synthetic peptide directed towards the N terminal of human EDF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRG
EDVET SKKWAAGQNK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references EDF-1 contributes to the regulation of nitric oxide release in VEGF-treated human endothelial cells.
The effects of silencing EDF-1 in human endothelial cells.
Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis.
Characterization of the human EDF-1 minimal promoter: involvement of NFY and Sp1 in the regulation of basal transcription.
Leidi M, Mariotti M, Maier JA
European journal of cell biology 2010 Sep;89(9):654-60
European journal of cell biology 2010 Sep;89(9):654-60
The effects of silencing EDF-1 in human endothelial cells.
Leidi M, Mariotti M, Maier JA
Atherosclerosis 2010 Jul;211(1):55-60
Atherosclerosis 2010 Jul;211(1):55-60
Transcriptional coactivator EDF-1 is required for PPARgamma-stimulated adipogenesis.
Leidi M, Mariotti M, Maier JA
Cellular and molecular life sciences : CMLS 2009 Aug;66(16):2733-42
Cellular and molecular life sciences : CMLS 2009 Aug;66(16):2733-42
Characterization of the human EDF-1 minimal promoter: involvement of NFY and Sp1 in the regulation of basal transcription.
Bolognese F, Pitarque-Martì M, Lo Cicero V, Mantovani R, Maier JA
Gene 2006 Jun 7;374:87-95
Gene 2006 Jun 7;374:87-95
No comments: Submit comment
No validations: Submit validation data