HPA027620

RNF26 antibody from Sigma-Aldrich
MGC2642
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027620
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027620, RRID:AB_1856356
Product name
Anti-RNF26 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027620
Antibody type
Polyclonal
Antigen
RING finger protein 26 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSYHRLREDVMRLSRLALGSEAWRRVWSRSLQLAS
WPNRGGAPGAPQGDPMRVFSVRTRRQDTLPEAGRR
SEAEEEEARTIRVTPVRGRERLNEEEPPGGQDPWK
LLKEQEERKKCVICQDQSKTVLLLPC
Storage
-20C
Provider Type Product Number
- No reagents -