WH0025788M1

RAD54B antibody from Sigma-Aldrich
RDH54
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0025788M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0025788M1, RRID:AB_1843252
Product name
Monoclonal Anti-RAD54B antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0025788M1
Antibody type
Monoclonal
Antigen
RAD54B (AAH01965, a.a. 801-910) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
HIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEE
VHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQ
LKQWKHFSGDHLNLTDPFLERITENVSFIFQNITT
QATGT (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -