Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405087 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RAD54 Homolog B (S. Cerevisiae) (RAD54B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITEN
VSFIF QNITTQATGT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Loss of heterozygosity in the RAD54B region is not predictive for breast carcinomas.
BryĆ M, Nowacka-Zawisza M, Romanowicz-Makowska H, Zadrozny M, Kulig A, Krajewska WM
Polish journal of pathology : official journal of the Polish Society of Pathologists 2007;58(1):3-6
Polish journal of pathology : official journal of the Polish Society of Pathologists 2007;58(1):3-6
No comments: Submit comment
No validations: Submit validation data