HPA007087

RAD54B antibody from Sigma-Aldrich
RDH54
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007087, RRID:AB_1856040
Product name
Anti-RAD54B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007087
Antibody type
Polyclonal
Antigen
DNA repair and recombination protein RAD54B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVL
IVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQ
TLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAI
SHSSQVARKCFSNP
Storage
-20C
Provider Type Product Number
- No reagents -