Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003748-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003748-M01, RRID:AB_566098
- Product name
- KCNC3 monoclonal antibody (M01), clone 1C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KCNC3.
- Antigen sequence
ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDR
ACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGP
PSFLPDLNANAAAWISP- Isotype
- IgG
- Antibody clone number
- 1C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Volumetric and ionic regulation during the in vitro development of a corneal endothelial barrier.
Alaminos M, González-Andrades M, Muñoz-Avila JI, Garzón I, Sánchez-Quevedo MC, Campos A
Experimental eye research 2008 May;86(5):758-69
Experimental eye research 2008 May;86(5):758-69
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KCNC3 monoclonal antibody (M01), clone 1C1 Western Blot analysis of KCNC3 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to KCNC3 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol