Antibody data

Product number
ABIN404981
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) antibody
Provider product page
antibodies-online - ABIN404981
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3
Reactivity
Human, Mouse, Rat, Bovine, Rabbit, Xenopus
Host
Rabbit
Antigen sequence
YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMT
TLGYG DMYPKTWSGM
Vial size
50 µg
Provider Type Product Number
- No reagents -