H00283489-B01P

CHAMP1 antibody from Abnova Corporation
C13orf8, CAMP, CHAMP, ZNF828

Antibody data

Product number
H00283489-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283489-B01P, RRID:AB_1673079
Product name
C13orf8 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00283489-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C13orf8 protein.
Antigen sequence
MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGT
IHPEFCDEMDAGGLGKMIFYQKSAKLFHCHKCFFT
SKMYSNVYYHITSKHASPDKWNDKPKNQLNKETDP
VKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSV
LSPESPKPTPLTPLEPQKPGSVVSPELQTPLPSPE
PSKPASVSSPEPPKSVPVCESQKLAPVPSPEPQKP
APVSPESVKATLSNPKPQKQSHFPETLGPPSASSP
ESPVLAASPEPWGPSPAASPESRKSARTTSPEPRK
PSPSESPEPWKPFPAVSPEPRRPAPAVSPGSWKPG
PPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKP
IPSVSPGPWKPTPSVSSASWKSSSVSPSSWKSPPA
SPESWKSGPPELRKTAPTLSPEHWKAVPPVSPELR
KPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQ
RKTSPASLDFPESQKSSRGGSPDLWKSSFFIEPQK
PVFPETRKPGPSGPSESPKAASDIWKPVLSIDTEP
RKPALFPEPAKTAPPASPEARKRALFPEPRKHALF
PELPKSALFSESQKAVELGDELQIDAIDDQKCDIL
VQEELLASPKKLLEDTLFPSSKKLKKDNQESSDAE
LSSSEYIKTDLDAMDIKGQESSSDQEQVDVESIDF
SKENKMDMTSPEQSRNVLQFTEEKEAFISEEEIAK
YMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVH
SPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRC
NFESNFPRGFKKHLTHCQSRHNEEANKKLMEALEP
PLEEQQI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -