HPA006623

CHAMP1 antibody from Atlas Antibodies
C13orf8, CAMP, CHAMP, ZNF828
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006623
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006623, RRID:AB_1233591
Product name
Anti-CHAMP1
Provider product page
Atlas Antibodies - HPA006623
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLP
EHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPK
PTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASV
SSPEPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -