HPA008900

CHAMP1 antibody from Atlas Antibodies
C13orf8, CAMP, CHAMP, ZNF828
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA008900
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008900, RRID:AB_1845547
Product name
Anti-CHAMP1
Provider product page
Atlas Antibodies - HPA008900
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKR
ALFPEPRKHALFPELPKSALFSESQKAVELGDELQ
IDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKK
LKKDNQESSDAELSSSEYIKTDLDAMDI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -