HPA008900

CHAMP1 antibody from Atlas Antibodies
C13orf8, CAMP, CHAMP, ZNF828
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA008900
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008900, RRID:AB_1233592
Product name
Anti-CHAMP1
Provider product page
Atlas Antibodies - HPA008900
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKR
ALFPEPRKHALFPELPKSALFSESQKAVELGDELQ
IDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKK
LKKDNQESSDAELSSSEYIKTDLDAMDI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -