HPA006623

CHAMP1 antibody from Sigma-Aldrich
C13orf8, CAMP, CHAMP, ZNF828
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006623
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006623, RRID:AB_1845548
Product name
Anti-C13orf8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006623
Antibody type
Polyclonal
Antigen
Zinc finger protein KIAA1802 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLP
EHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPK
PTPLTPLEPQKPGSVVSPELQTPLPSPEPSKPASV
SSPEPP
Storage
-20C
Provider Type Product Number
- No reagents -