HPA008900

CHAMP1 antibody from MilliporeSigma / Merck KGaA
C13orf8, CAMP, CHAMP, ZNF828
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008900
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008900, RRID:AB_1845547
Product name
Anti-C13orf8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008900
Antibody type
Polyclonal
Antigen
Zinc finger protein KIAA1802 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IWKPVLSIDTEPRKPALFPEPAKTAPPASPEARKR
ALFPEPRKHALFPELPKSALFSESQKAVELGDELQ
IDAIDDQKCDILVQEELLASPKKLLEDTLFPSSKK
LKKDNQESSDAELSSSEYIKTDLDAMDI
Storage
-20C
Provider Type Product Number
- No reagents -