Antibody data

Product number
ABIN504496
Provider
antibodies-online
Product name
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504496
Antibody type
Polyclonal
Antigen
The immunogen for anti-XRCC2 antibody: synthetic peptide directed towards the middle region of human XRCC2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQ
CLEKL VNDYRLVLFA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -