Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504496 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-XRCC2 antibody: synthetic peptide directed towards the middle region of human XRCC2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQ
CLEKL VNDYRLVLFA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Combinational polymorphisms of four DNA repair genes XRCC1, XRCC2, XRCC3, and XRCC4 and their association with oral cancer in Taiwan.
Yen CY, Liu SY, Chen CH, Tseng HF, Chuang LY, Yang CH, Lin YC, Wen CH, Chiang WF, Ho CH, Chen HC, Wang ST, Lin CW, Chang HW
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2008 May;37(5):271-7
Journal of oral pathology & medicine : official publication of the International Association of Oral Pathologists and the American Academy of Oral Pathology 2008 May;37(5):271-7
No comments: Submit comment
No validations: Submit validation data