ABIN630284

antibody from antibodies-online

Targeting: CSH1 CSA, CSMT, FLJ75407, hCS-A, PL

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630284 - Provider product page
Provider: antibodies-online
Product name: anti-Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1) antibody
Antibody type: Polyclonal
Antigen: CSH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

CSH1 protein structure - ABIN630284 shown in red.