HPA024680

LCN12 antibody from Sigma-Aldrich
MGC48935
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024680
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024680, RRID:AB_1852756
Product name
Anti-LCN12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024680
Antibody type
Polyclonal
Antigen
Epididymal-specific lipocalin-12 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTAT
FELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQ
Storage
-20C
Provider Type Product Number
- No reagents -