HPA006973

PHC1 antibody from Atlas Antibodies
EDR1, HPH1, RAE28
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006973
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006973, RRID:AB_1855278
Product name
Anti-PHC1
Provider product page
Atlas Antibodies - HPA006973
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLI
LMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVR
NQQASAQGPQMQGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -