HPA006973

PHC1 antibody from Sigma-Aldrich
EDR1, HPH1, RAE28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006973
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006973, RRID:AB_1855278
Product name
Anti-PHC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006973
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein DKFZp686A1782 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLI
LMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVR
NQQASAQGPQMQGS
Storage
-20C
Provider Type Product Number
- No reagents -