H00007879-M

RAB7A antibody from Abnova Corporation
RAB7
No application information provided.

Antibody data

Product number
H00007879-M
Provider
Abnova Corporation
Product name
RAB7A mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00007879-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RAB7A.
Antigen sequence
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSN
QYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF
QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDE
FLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ
AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALK
QETEVELYNEFPEPIKLDKNDRAKASAESCSC
Provider Type Product Number
- No reagents -