HPA006964

RAB7A antibody from Atlas Antibodies
RAB7
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006964
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006964, RRID:AB_1235397
Product name
Anti-RAB7A
Provider product page
Atlas Antibodies - HPA006964
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENF
PFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFE
TSAKEAINVEQAFQTIARNALKQETEVELYNEFPE
PIKLDKNDRAK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -