HPA006964

RAB7A antibody from Atlas Antibodies
CMT2B, RAB7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006964
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006964, RRID:AB_1856015
Product name
Anti-RAB7A
Provider product page
Atlas Antibodies - HPA006964
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENF
PFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFE
TSAKEAINVEQAFQTIARNALKQETEVELYNEFPE
PIKLDKNDRAK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -