HPA020586

BAG3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020586
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020586, RRID:AB_1845258
Product name
Anti-BAG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020586
Antibody type
Polyclonal
Antigen
BAG family molecular chaperone regulator 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DCSSSSSSASLPSSGRSSLGSHQLPRGYISIPVIH
EQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVY
HKIQGDDWEPRPLRAASPFRSSVQGASSREGSPAR
SSTPLHSPSPIRVHTVVDRPQQPMTHRET
Storage
-20C
Provider Type Product Number
- No reagents -