Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502181 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHD
QELQR IQERVKTFPS- Vial size
- 50 µg
Submitted references Antibodies to canine and feline viruses in spotted hyenas (Crocuta crocuta) in the Masai Mara National Reserve.
Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
Harrison TM, Mazet JK, Holekamp KE, Dubovi E, Engh AL, Nelson K, Van Horn RC, Munson L
Journal of wildlife diseases 2004 Jan;40(1):1-10
Journal of wildlife diseases 2004 Jan;40(1):1-10
Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
Nelson DR, Zeldin DC, Hoffman SM, Maltais LJ, Wain HM, Nebert DW
Pharmacogenetics 2004 Jan;14(1):1-18
Pharmacogenetics 2004 Jan;14(1):1-18
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting