HPA020053

TRIM29 antibody from Atlas Antibodies
ATDC, FLJ36085
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020053
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020053, RRID:AB_1858280
Product name
Anti-TRIM29
Provider product page
Atlas Antibodies - HPA020053
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPR
ADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVC
QASFCELHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -