HPA020053

TRIM29 antibody from Sigma-Aldrich
ATDC, FLJ36085
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020053
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020053, RRID:AB_1858280
Product name
Anti-TRIM29 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020053
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPR
ADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVC
QASFCELHL
Storage
-20C
Provider Type Product Number
- No reagents -