WH0011261M1

CHP1 antibody from Sigma-Aldrich
CHP, p22, p24, Sid470p, SLC9A1BP
ELISA
Recommended by provider

Antibody data

Product number
WH0011261M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0011261M1, RRID:AB_1840699
Product name
Monoclonal Anti-CHP antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0011261M1
Antibody type
Monoclonal
Antigen
CHP (AAH08373, a.a. 1-67) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLP
SSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS* (w
ithout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -