H00011261-D01P

CHP1 antibody from Abnova Corporation
CHP, p22, p24, Sid470p, SLC9A1BP

Antibody data

Product number
H00011261-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011261-D01P, RRID:AB_1673232
Product name
CHP purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00011261-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CHP protein.
Antigen sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRF
TSLDKGENGTLSREDFQRIPELAINPLGDRIINAF
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGP
EPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTE
FVKVLEKVDVEQKMSIRFLH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -