HPA006616

CHP1 antibody from Sigma-Aldrich
CHP, p22, p24, Sid470p, SLC9A1BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006616, RRID:AB_1857461
Product name
Anti-AC012652.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006616
Antibody type
Polyclonal
Antigen
Calcium-binding protein p22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPE
LAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFR
PIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDK
DEKISRDELLQVLRMMVGVNIS
Storage
-20C
Provider Type Product Number
- No reagents -