HPA021577

C9orf139 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021577
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021577, RRID:AB_1845814
Product name
Anti-C9orf139 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021577
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf139 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPG
QGGCHGAQSCVGTCELANGARGFCPEMGQNESLSE
ERKGHESKRKS
Storage
-20C
Provider Type Product Number
- No reagents -