Explore
Validate
LearnPAB21419
antibody from Abnova Corporation
Targeting: RBM33
DKFZp434D1319, DKFZp686F102, MGC20460, PRR8
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21419 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21419, RRID:AB_10965977
- Product name
- RBM33 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant RBM33.
- Antigen sequence
AGARKKELLERLAQQQQQLYAPPPPAEQEEQALSP
SPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISN
VQPKT- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RBM33 polyclonal antibody (Cat # PAB21419) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder with RBM33 polyclonal antibody (Cat # PAB21419) shows distinct cytoplasmic and nuclear positivity in urothelial cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
