HPA021497

RBM33 antibody from Sigma-Aldrich
DKFZp434D1319, DKFZp686F102, MGC20460, PRR8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021497
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021497, RRID:AB_2176261
Product name
Anti-RBM33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021497
Antibody type
Polyclonal
Antigen
RNA-binding protein 33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGARKKELLERLAQQQQQLYAPPPPAEQEEQALSP
SPTNGNPLLPFPGAQVRQNVKNRLLVKNQDVSISN
VQPKT
Storage
-20C
Provider Type Product Number
- No reagents -