Antibody data

Product number
H00056681-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056681-M01, RRID:AB_1137022
Product name
SAR1A monoclonal antibody (M01), clone 3G5
Provider product page
Abnova Corporation - H00056681-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SAR1A.
Antigen sequence
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDN
AGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADH
SRLVESKVELNALMTDETISNVPILILGNKIDRTD
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEV
FMCSVLKRQGYGEGFRWLSQYID
Isotype
IgG
Antibody clone number
3G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -