HPA006923

SAR1A antibody from Atlas Antibodies
SAR1, Sara, SARA1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006923
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006923, RRID:AB_1235479
Product name
Anti-SAR1A
Provider product page
Atlas Antibodies - HPA006923
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRL
VESKVELNALMTDETISNVPILILGNKIDRTDAIS
EEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMC
SVLKRQGYGEGFRWLSQY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -