HPA006923

SAR1A antibody from Atlas Antibodies
SAR1, Sara, SARA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006923
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006923, RRID:AB_1856577
Product name
Anti-SAR1A
Provider product page
Atlas Antibodies - HPA006923
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRL
VESKVELNALMTDETISNVPILILGNKIDRTDAIS
EEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMC
SVLKRQGYGEGFRWLSQY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -