HPA006923

SAR1A antibody from Sigma-Aldrich
SAR1, Sara, SARA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006923, RRID:AB_1856577
Product name
Anti-SAR1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006923
Antibody type
Polyclonal
Antigen
GTP-binding protein SAR1a recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRL
VESKVELNALMTDETISNVPILILGNKIDRTDAIS
EEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMC
SVLKRQGYGEGFRWLSQY
Storage
-20C
Provider Type Product Number
- No reagents -