HPA008304

LPGAT1 antibody from Sigma-Aldrich
FAM34A, FAM34A1, KIAA0205, NET8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008304
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008304, RRID:AB_1079272
Product name
Anti-LPGAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008304
Antibody type
Polyclonal
Antigen
Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVA
QQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKA
EPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETD
DLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEA
VSREMT
Storage
-20C
Provider Type Product Number
- No reagents -