ABIN629739

antibody from antibodies-online

Targeting: RNF32 FKSG33, HSD15, LMBR2

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629739 - Provider product page
Provider: antibodies-online
Product name: anti-Ring Finger Protein 32 (RNF32) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: RNF32 antibody was raised using the middle region of RNF32 corresponding to a region with amino acids ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

RNF32 protein structure - ABIN629739 shown in red.