Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310452 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 32 (RNF32) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF32 antibody: synthetic peptide directed towards the middle region of human RNF32
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLF
RIKCV TRIQAYWRGC- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A double RING-H2 domain in RNF32, a gene expressed during sperm formation.
van Baren MJ, van der Linde HC, Breedveld GJ, Baarends WM, Rizzu P, de Graaff E, Oostra BA, Heutink P
Biochemical and biophysical research communications 2002 Mar 22;292(1):58-65
Biochemical and biophysical research communications 2002 Mar 22;292(1):58-65
No comments: Submit comment
No validations: Submit validation data