Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054165-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054165-M01, RRID:AB_606130
- Product name
- DCUN1D1 monoclonal antibody (M01), clone 3D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DCUN1D1.
- Antigen sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDW
KLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
RYKDPQDENKIGIDGIQQF- Isotype
- IgG
- Antibody clone number
- 3D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DCUN1D1 monoclonal antibody (M01), clone 3D7 Western Blot analysis of DCUN1D1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DCUN1D1 monoclonal antibody (M01), clone 3D7. Western Blot analysis of DCUN1D1 expression in Raw 264.7(Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DCUN1D1 expression in transfected 293T cell line by DCUN1D1 monoclonal antibody (M01), clone 3D7.Lane 1: DCUN1D1 transfected lysate(30.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DCUN1D1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol