Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310365 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKL
EQLYN RYKDPQDENK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
Kurz T, Ozlü N, Rudolf F, O'Rourke SM, Luke B, Hofmann K, Hyman AA, Bowerman B, Peter M
Nature 2005 Jun 30;435(7046):1257-61
Nature 2005 Jun 30;435(7046):1257-61
No comments: Submit comment
No validations: Submit validation data