HPA032130

SHANK1 antibody from Atlas Antibodies
SPANK-1, SSTRIP, synamon
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA032130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA032130, RRID:AB_2674169
Product name
Anti-SHANK1
Provider product page
Atlas Antibodies - HPA032130
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMA
LNKLDEILAAAQQTISASESPGPGGLASLGKHRPK
GFFATESSFDPHHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -