HPA032129

SHANK1 antibody from Atlas Antibodies
SPANK-1, SSTRIP, synamon
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA032129
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA032129, RRID:AB_10602796
Product name
Anti-SHANK1
Provider product page
Atlas Antibodies - HPA032129
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVKASIISELSSKLQQFGGSSAAGGALPWARGGSG
GGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLS
KPVSSLFQNWPKPPLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -