H00050944-M01

SHANK1 antibody from Abnova Corporation
SPANK-1, SSTRIP, synamon

Antibody data

Product number
H00050944-M01
Provider
Abnova Corporation
Product name
SHANK1 monoclonal antibody (M01), clone 8F7
Provider product page
Abnova Corporation - H00050944-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SHANK1.
Antigen sequence
KPFGAKPLGFWTKFDVADWLEWLGLAEHRAQFLDH
EIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKF
FLER
Isotype
IgG
Antibody clone number
8F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -