HPA006625

NCLN antibody from Atlas Antibodies
NET59, NICALIN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006625
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006625, RRID:AB_888679
Product name
Anti-NCLN
Provider product page
Atlas Antibodies - HPA006625
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQD
VVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYK
QTQAASASQGSASAAEVLLRTATANGFQMVTSGVQ
SKAVSDWLIASVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -