HPA006625

NCLN antibody from Sigma-Aldrich
NET59, NICALIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006625
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006625, RRID:AB_1079453
Product name
Anti-NCLN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006625
Antibody type
Polyclonal
Antigen
Nicalin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQD
VVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYK
QTQAASASQGSASAAEVLLRTATANGFQMVTSGVQ
SKAVSDWLIASVE
Storage
-20C
Provider Type Product Number
- No reagents -