HPA018870

TECTA antibody from Sigma-Aldrich
DFNA12, DFNA8, DFNB21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018870
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018870, RRID:AB_1857879
Product name
Anti-TECTA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018870
Antibody type
Polyclonal
Antigen
Alpha-tectorin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDI
NKKKPDAGPAWLRGLRILVADQEVKIGGIGASEVK
LNGQE
Storage
-20C
Provider Type Product Number
- No reagents -