HPA029140

FBXL4 antibody from Sigma-Aldrich
FBL4, FBL5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029140, RRID:AB_10611967
Product name
Anti-FBXL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029140
Antibody type
Polyclonal
Antigen
F-box and leucine-rich repeat protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTA
VFRTYGTWWDQCPSA
Storage
-20C
Provider Type Product Number
- No reagents -