HPA015876

HSPB8 antibody from Sigma-Aldrich
CMT2L, E2IG1, H11, HSP22, HspB8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015876
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015876, RRID:AB_1850458
Product name
Anti-HSPB8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015876
Antibody type
Polyclonal
Antigen
Heat shock protein beta-8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTL
RSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVC
VNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGI
VSKNFTKKIQLP
Storage
-20C
Provider Type Product Number
- No reagents -