HPA015876

HSPB8 antibody from Atlas Antibodies
CMT2L, E2IG1, H11, HSP22, HspB8
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA015876
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015876, RRID:AB_1850458
Product name
Anti-HSPB8
Provider product page
Atlas Antibodies - HPA015876
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTL
RSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVC
VNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGI
VSKNFTKKIQLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -