WH0064327M5

LMBR1 antibody from Sigma-Aldrich
ACHP, C7orf2, FLJ11665, ZRS
ELISA
Recommended by provider

Antibody data

Product number
WH0064327M5
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0064327M5, RRID:AB_1842301
Product name
Monoclonal Anti-LMBR1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0064327M5
Antibody type
Monoclonal
Antigen
LMBR1 (NP_071903, a.a. 214-296) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQ
RRLNGLSSSVEYNIMELEQELENVKTLKTKLERRK
KASAWERNLVYP* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -